PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_7115g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 293aa    MW: 32791.7 Da    PI: 6.5078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_7115g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53e-131360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+  Ed +l ++++ +G g W+  +++ g++R++k+c++rw +yl
     MA_7115g0010 13 RGAWSRKEDMILSEYIRIHGDGGWTNLPQRAGLKRCGKSCRLRWTNYL 60
                     89********************************************97 PP

2Myb_DNA-binding49.41.1e-1568109346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +++Edel+++ +++lG++ W++Ia +++ gRt++++k++w++
     MA_7115g0010  68 NISPDEDELIIRMHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 109
                      669*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.844860IPR017930Myb domain
SuperFamilySSF466893.33E-2711107IPR009057Homeodomain-like
SMARTSM007172.1E-101262IPR001005SANT/Myb domain
PfamPF002494.0E-121360IPR001005SANT/Myb domain
CDDcd001679.72E-81560No hitNo description
PROSITE profilePS5129424.14661115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2464115IPR009057Homeodomain-like
SMARTSM007171.1E-1465113IPR001005SANT/Myb domain
PfamPF002495.7E-1468109IPR001005SANT/Myb domain
CDDcd001678.38E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGRSCCSKEG LNRGAWSRKE DMILSEYIRI HGDGGWTNLP QRAGLKRCGK SCRLRWTNYL  60
RPDIKLGNIS PDEDELIIRM HRLLGNRWSL IAGRLPGRTD NEIKNYWNTR LSKKLLSIDD  120
SQSKSTARNL ETSSKSPPPP PNHVFKTTPI KITTAVKFSE TVGPKRCNGY GRSNCSSAEA  180
IKLCNIKENT NSIPHDDSEH IVFDMTDVNL LETEAGNCTS AIWSLEEERS PHSYYFAVDT  240
ATLDESLSEL NVLSSPDCNL LYSASGSSTD FELEEFYREA ATLATGINDS VFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S9K91e-58MYB3_ARATH; Transcription factor MYB3
TrEMBLB8LMJ61e-120B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.18e-60myb domain protein 3